Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [272918] (2 PDB entries) |
Domain d4q47a3: 4q47 A:408-517 [272919] Other proteins in same PDB: d4q47a1, d4q47a2, d4q47a4, d4q47b1, d4q47b2 automated match to d1oywa1 protein/DNA complex; complexed with adp, zn |
PDB Entry: 4q47 (more details), 2.9 Å
SCOPe Domain Sequences for d4q47a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q47a3 a.4.5.0 (A:408-517) automated matches {Deinococcus radiodurans [TaxId: 243230]} prvrdltreaqmalsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehde klwrsvlrqlvslgylsaddhfglratgksrgilkegqklllredtllpg
Timeline for d4q47a3: