Lineage for d4q47b3 (4q47 B:408-514)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (73 species)
    not a true protein
  7. 2307258Species Deinococcus radiodurans [TaxId:243230] [272918] (2 PDB entries)
  8. 2307262Domain d4q47b3: 4q47 B:408-514 [272928]
    Other proteins in same PDB: d4q47a1, d4q47a2, d4q47a4, d4q47b1, d4q47b2
    automated match to d1oywa1
    protein/DNA complex; complexed with adp, zn

Details for d4q47b3

PDB Entry: 4q47 (more details), 2.9 Å

PDB Description: structure of the drrecq catalytic core in complex with adp
PDB Compounds: (B:) DNA helicase RecQ

SCOPe Domain Sequences for d4q47b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q47b3 a.4.5.0 (B:408-514) automated matches {Deinococcus radiodurans [TaxId: 243230]}
prvrdltreaqmalsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehde
klwrsvlrqlvslgylsaddhfglratgksrgilkegqklllredtl

SCOPe Domain Coordinates for d4q47b3:

Click to download the PDB-style file with coordinates for d4q47b3.
(The format of our PDB-style files is described here.)

Timeline for d4q47b3: