Lineage for d4pbfa_ (4pbf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833482Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2833602Protein automated matches [190258] (3 species)
    not a true protein
  7. 2833606Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)
  8. 2833657Domain d4pbfa_: 4pbf A: [272288]
    automated match to d1qw7a_
    complexed with cac, mpd, zn

Details for d4pbfa_

PDB Entry: 4pbf (more details), 1.9 Å

PDB Description: phosphotriesterase variant rev12
PDB Compounds: (A:) Phosphotriesterase variant PTE-revR12

SCOPe Domain Sequences for d4pbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pbfa_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]}
gdrintvrgpiaiseagftlthehicgssagflrawpeffgsrealvekavrglrraraa
gvrtivdvttfdlgrdvrllaevsraadvhivaatgmwldpsltirmrsvveltqfflre
iqhgiedtgiragiikvattdkmtpfqelvlraaaraslatgvpvithtegsqrggeqqa
aifeseglspsrvcighsdetddlsyltalaargyligldriphnaiglednasatalmg
srswqtrallikalidqgykkqilvsndwlfgmscyvtnfmdvmdsvnpdgmafiplrvi
pflrekgtpqetlagitvtnparflsptl

SCOPe Domain Coordinates for d4pbfa_:

Click to download the PDB-style file with coordinates for d4pbfa_.
(The format of our PDB-style files is described here.)

Timeline for d4pbfa_: