SCOPe 2.08: Domain d4pbfa_: 4pbf A:

Lineage for d4pbfa_ (4pbf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein automated matches [190258] (3 species)
   not a true protein

7. Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)

8. Domain d4pbfa_: 4pbf A: [272288]
   automated match to d1qw7a_
   complexed with cac, mpd, zn

Details for d4pbfa_

PDB Entry: 4pbf, 1.9 Å

PDB Description: phosphotriesterase variant rev12

PDB Compounds: (A:) Phosphotriesterase variant PTE-revR12

SCOPe Domain Sequences for d4pbfa_:

Sequence; same for both SEQRES and ATOM records:

>d4pbfa_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]}
gdrintvrgpiaiseagftlthehicgssagflrawpeffgsrealvekavrglrraraa
gvrtivdvttfdlgrdvrllaevsraadvhivaatgmwldpsltirmrsvveltqfflre
iqhgiedtgiragiikvattdkmtpfqelvlraaaraslatgvpvithtegsqrggeqqa
aifeseglspsrvcighsdetddlsyltalaargyligldriphnaiglednasatalmg
srswqtrallikalidqgykkqilvsndwlfgmscyvtnfmdvmdsvnpdgmafiplrvi
pflrekgtpqetlagitvtnparflsptl

Timeline for d4pbfa_:

• d4pbfa_ first appeared in SCOPe 2.05
  
• d4pbfa_ appears in SCOPe 2.07