Lineage for d1opbd_ (1opb D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins) 
Protein Cellular retinol-binding protein II (CRBP) [50864] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [50865] (5 PDB entries) 
Domain d1opbd_: 1opb D: [27219]
Details for d1opbd_
PDB Entry: 1opb (more details), 1.9 Å
PDB Description: the crystal structures of holo-and apo-cellular retinol binding protein ii
SCOP Domain Sequences for d1opbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opbd_ b.60.1.2 (D:) Cellular retinol-binding protein II (CRBP) {Rat (Rattus norvegicus)}
tkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrny
dldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylelt
cgdqvcrqvfkkk
SCOP Domain Coordinates for d1opbd_:
Click to download the PDB-style file with coordinates for d1opbd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1opbd_:
- d1opbd_ appears in SCOP 1.57
- d1opbd_ appears in the current release, SCOPe 2.08
View in 3D
