Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [50865] (9 PDB entries) |
Domain d1opbd_: 1opb D: [27219] complexed with ret |
PDB Entry: 1opb (more details), 1.9 Å
SCOPe Domain Sequences for d1opbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opbd_ b.60.1.2 (D:) Cellular retinol-binding protein II (CRBP) {Norway rat (Rattus norvegicus) [TaxId: 10116]} tkdqngtwemesnenfegymkaldidfatrkiavrltqtkiivqdgdnfktktnstfrny dldftvgvefdehtkgldgrnvktlvtwegntlvcvqkgekenrgwkqwvegdklylelt cgdqvcrqvfkkk
Timeline for d1opbd_: