![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Spore coat protein A, CotA, middle domain [418913] (2 species) |
![]() | Species Bacillus subtilis [TaxId:224308] [419337] (8 PDB entries) |
![]() | Domain d4q89a2: 4q89 A:183-356 [271941] Other proteins in same PDB: d4q89a1, d4q89a3, d4q89b1, d4q89b3 automated match to d3zdwa2 complexed with cl, cu has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4q89 (more details), 2.31 Å
SCOPe Domain Sequences for d4q89a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q89a2 b.6.1.3 (A:183-356) Spore coat protein A, CotA, middle domain {Bacillus subtilis [TaxId: 224308]} klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla
Timeline for d4q89a2: