SCOPe 2.08: Domain d4q89b1: 4q89 B:2-182

Lineage for d4q89b1 (4q89 B:2-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species)

7. Species Bacillus subtilis [TaxId:224308] [419336] (8 PDB entries)

8. Domain d4q89b1: 4q89 B:2-182 [271932]
   Other proteins in same PDB: d4q89a2, d4q89b2
   automated match to d3zdwa1
   complexed with cl, cu

Details for d4q89b1

PDB Entry: 4q89, 2.31 Å

PDB Description: crystal structure of the cota native enzyme

PDB Compounds: (B:) spore coat protein a

SCOPe Domain Sequences for d4q89b1:

Sequence, based on SEQRES records:

>d4q89b1 b.6.1.3 (B:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records):

>d4q89b1 b.6.1.3 (B:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtiheepevktvvhlhggvtpddsdgypeawfskdf
eqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

Timeline for d4q89b1:

• d4q89b1 first appeared in SCOPe 2.05
  
• d4q89b1 appears in SCOPe 2.07