Lineage for d4q89a1 (4q89 A:1-182)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2367751Protein Spore coat protein A, CotA [89219] (2 species)
  7. 2367792Species Bacillus subtilis [TaxId:224308] [271928] (8 PDB entries)
  8. 2367805Domain d4q89a1: 4q89 A:1-182 [271939]
    automated match to d3zdwa1
    complexed with cl, cu

Details for d4q89a1

PDB Entry: 4q89 (more details), 2.31 Å

PDB Description: crystal structure of the cota native enzyme
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4q89a1:

Sequence, based on SEQRES records: (download)

>d4q89a1 b.6.1.3 (A:1-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
rl

Sequence, based on observed residues (ATOM records): (download)

>d4q89a1 b.6.1.3 (A:1-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]}
mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
evkrnenvyvkwmnnlpsthflpidhtihqheepevktvvhlhggvtpddsdgypeawfs
kdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

SCOPe Domain Coordinates for d4q89a1:

Click to download the PDB-style file with coordinates for d4q89a1.
(The format of our PDB-style files is described here.)

Timeline for d4q89a1: