Lineage for d4q89b3 (4q89 B:357-511)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771966Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species)
  7. 2771994Species Bacillus subtilis [TaxId:224308] [419336] (8 PDB entries)
  8. 2772010Domain d4q89b3: 4q89 B:357-511 [271937]
    Other proteins in same PDB: d4q89a2, d4q89b2
    automated match to d3zdwa3
    complexed with cl, cu

Details for d4q89b3

PDB Entry: 4q89 (more details), 2.31 Å

PDB Description: crystal structure of the cota native enzyme
PDB Compounds: (B:) spore coat protein a

SCOPe Domain Sequences for d4q89b3:

Sequence, based on SEQRES records: (download)

>d4q89b3 b.6.1.3 (B:357-511) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

Sequence, based on observed residues (ATOM records): (download)

>d4q89b3 b.6.1.3 (B:357-511) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 224308]}
sypriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpi
hlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatf
gpysgryvwhchilehedydmmrpmditdp

SCOPe Domain Coordinates for d4q89b3:

Click to download the PDB-style file with coordinates for d4q89b3.
(The format of our PDB-style files is described here.)

Timeline for d4q89b3: