![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Blomia tropicalis [TaxId:40697] [270994] (1 PDB entry) |
![]() | Domain d4q5na1: 4q5n A:3-85 [271018] Other proteins in same PDB: d4q5na2, d4q5nb2 automated match to d3gtub2 complexed with gsh |
PDB Entry: 4q5n (more details), 2.55 Å
SCOPe Domain Sequences for d4q5na1:
Sequence, based on SEQRES records: (download)
>d4q5na1 c.47.1.0 (A:3-85) automated matches {Blomia tropicalis [TaxId: 40697]} plkigywdvrgfaepirmllkhlniefeetrygfgndseeslpnrdewlaekftlglefp nlpylfdgdfkmtesvailkrla
>d4q5na1 c.47.1.0 (A:3-85) automated matches {Blomia tropicalis [TaxId: 40697]} plkigywdvrgfaepirmllkhlniefeetrygflpnrdewlaekftlglefpnlpylfd gdfkmtesvailkrla
Timeline for d4q5na1: