SCOPe 2.08: Domain d4q5na1: 4q5n A:3-85

Lineage for d4q5na1 (4q5n A:3-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Blomia tropicalis [TaxId:40697] [270994] (1 PDB entry)

8. Domain d4q5na1: 4q5n A:3-85 [271018]
   Other proteins in same PDB: d4q5na2, d4q5nb2
   automated match to d3gtub2
   complexed with gsh

Details for d4q5na1

PDB Entry: 4q5n, 2.55 Å

PDB Description: crystal structure of the gluthatione s-transferase blo t 8

PDB Compounds: (A:) Gluthatione S-transferase Blo t 8 isoform

SCOPe Domain Sequences for d4q5na1:

Sequence, based on SEQRES records:

>d4q5na1 c.47.1.0 (A:3-85) automated matches {Blomia tropicalis [TaxId: 40697]}
plkigywdvrgfaepirmllkhlniefeetrygfgndseeslpnrdewlaekftlglefp
nlpylfdgdfkmtesvailkrla

Sequence, based on observed residues (ATOM records):

>d4q5na1 c.47.1.0 (A:3-85) automated matches {Blomia tropicalis [TaxId: 40697]}
plkigywdvrgfaepirmllkhlniefeetrygflpnrdewlaekftlglefpnlpylfd
gdfkmtesvailkrla

Timeline for d4q5na1:

• d4q5na1 first appeared in SCOPe 2.05
  
• d4q5na1 appears in SCOPe 2.07