Lineage for d4q5nb1 (4q5n B:4-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879218Species Blomia tropicalis [TaxId:40697] [270994] (1 PDB entry)
  8. 2879220Domain d4q5nb1: 4q5n B:4-85 [271000]
    Other proteins in same PDB: d4q5na2, d4q5nb2
    automated match to d3gtub2
    complexed with gsh

Details for d4q5nb1

PDB Entry: 4q5n (more details), 2.55 Å

PDB Description: crystal structure of the gluthatione s-transferase blo t 8
PDB Compounds: (B:) Gluthatione S-transferase Blo t 8 isoform

SCOPe Domain Sequences for d4q5nb1:

Sequence, based on SEQRES records: (download)

>d4q5nb1 c.47.1.0 (B:4-85) automated matches {Blomia tropicalis [TaxId: 40697]}
lkigywdvrgfaepirmllkhlniefeetrygfgndseeslpnrdewlaekftlglefpn
lpylfdgdfkmtesvailkrla

Sequence, based on observed residues (ATOM records): (download)

>d4q5nb1 c.47.1.0 (B:4-85) automated matches {Blomia tropicalis [TaxId: 40697]}
lkigywdvrgfaepirmllkhlniefeetrygflpnrdewlaekftlglefpnlpylfdg
dfkmtesvailkrla

SCOPe Domain Coordinates for d4q5nb1:

Click to download the PDB-style file with coordinates for d4q5nb1.
(The format of our PDB-style files is described here.)

Timeline for d4q5nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q5nb2