SCOPe 2.08: Domain d4q5nb2: 4q5n B:86-231

Lineage for d4q5nb2 (4q5n B:86-231)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Blomia tropicalis [TaxId:40697] [271008] (1 PDB entry)

8. Domain d4q5nb2: 4q5n B:86-231 [271010]
   Other proteins in same PDB: d4q5na1, d4q5nb1
   automated match to d3gtub1
   complexed with gsh

Details for d4q5nb2

PDB Entry: 4q5n, 2.55 Å

PDB Description: crystal structure of the gluthatione s-transferase blo t 8

PDB Compounds: (B:) Gluthatione S-transferase Blo t 8 isoform

SCOPe Domain Sequences for d4q5nb2:

Sequence, based on SEQRES records:

>d4q5nb2 a.45.1.0 (B:86-231) automated matches {Blomia tropicalis [TaxId: 40697]}
rangmiattepalsysemieamiidirnrlinvvyaensgtpeefeqkladlrerletsl
gqleaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfakvsdymkrfeel
pslkeyiardehrsasclspfarigh

Sequence, based on observed residues (ATOM records):

>d4q5nb2 a.45.1.0 (B:86-231) automated matches {Blomia tropicalis [TaxId: 40697]}
rangmiattepalsysemieamiidirnrlinvvyaetpeefeqkladlrerletslgql
eaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfakvsdymkrfeelpsl
keyiardehrsasclspfarigh

Timeline for d4q5nb2:

• d4q5nb2 first appeared in SCOPe 2.05
  
• d4q5nb2 appears in SCOPe 2.07