Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Escherichia coli [TaxId:562] [270946] (4 PDB entries) |
Domain d4lq1a1: 4lq1 A:117-226 [270961] Other proteins in same PDB: d4lq1a2, d4lq1a3, d4lq1b2, d4lq1b3, d4lq1c2, d4lq1c3, d4lq1d2, d4lq1d3 automated match to d1m7xa1 complexed with bgc, gol |
PDB Entry: 4lq1 (more details), 2.55 Å
SCOPe Domain Sequences for d4lq1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lq1a1 b.1.18.0 (A:117-226) automated matches {Escherichia coli [TaxId: 562]} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
Timeline for d4lq1a1: