Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Escherichia coli [TaxId:562] [270953] (4 PDB entries) |
Domain d4lq1a3: 4lq1 A:623-728 [270971] Other proteins in same PDB: d4lq1a1, d4lq1a2, d4lq1b1, d4lq1b2, d4lq1c1, d4lq1c2, d4lq1d1, d4lq1d2 automated match to d1m7xa2 complexed with bgc, gol |
PDB Entry: 4lq1 (more details), 2.55 Å
SCOPe Domain Sequences for d4lq1a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lq1a3 b.71.1.0 (A:623-728) automated matches {Escherichia coli [TaxId: 562]} pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
Timeline for d4lq1a3: