| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
| Domain d4y5yf2: 4y5y F:117-224 [270877] Other proteins in same PDB: d4y5ya_, d4y5yb_, d4y5yd_, d4y5ye_ automated match to d1cn4b2 complexed with gol |
PDB Entry: 4y5y (more details), 2.85 Å
SCOPe Domain Sequences for d4y5yf2:
Sequence, based on SEQRES records: (download)
>d4y5yf2 b.1.2.1 (F:117-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsld
>d4y5yf2 b.1.2.1 (F:117-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladghvvlrwlpppetpmtshiryevdvsagqgagsvqrveilegr
tecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsld
Timeline for d4y5yf2: