Lineage for d4y5yf1 (4y5y F:9-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762224Domain d4y5yf1: 4y5y F:9-116 [270876]
    Other proteins in same PDB: d4y5ya_, d4y5yb_, d4y5yd_, d4y5ye_
    automated match to d1eerb1
    complexed with gol

Details for d4y5yf1

PDB Entry: 4y5y (more details), 2.85 Å

PDB Description: diabody 330 complex with epor
PDB Compounds: (F:) erythropoietin receptor

SCOPe Domain Sequences for d4y5yf1:

Sequence, based on SEQRES records: (download)

>d4y5yf1 b.1.2.1 (F:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklcr
lhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records): (download)

>d4y5yf1 b.1.2.1 (F:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfeskaallaargpeellcfterledlvcfweeaapgqysfsyqledepwklcrlhqap
targavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d4y5yf1:

Click to download the PDB-style file with coordinates for d4y5yf1.
(The format of our PDB-style files is described here.)

Timeline for d4y5yf1: