Lineage for d4y5ye_ (4y5y E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758848Domain d4y5ye_: 4y5y E: [270893]
    Other proteins in same PDB: d4y5ya_, d4y5yc1, d4y5yc2, d4y5yd_, d4y5yf1, d4y5yf2
    automated match to d3lrga_
    complexed with gol

Details for d4y5ye_

PDB Entry: 4y5y (more details), 2.85 Å

PDB Description: diabody 330 complex with epor
PDB Compounds: (E:) diabody 330 VL domain

SCOPe Domain Sequences for d4y5ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5ye_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqppsasgspgqsvtisctgtssdvgaynyvswyqqhpgkapklmiyevarrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyagsnnfavfgrgtkltvla

SCOPe Domain Coordinates for d4y5ye_:

Click to download the PDB-style file with coordinates for d4y5ye_.
(The format of our PDB-style files is described here.)

Timeline for d4y5ye_: