Lineage for d4u39g1 (4u39 G:14-201)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121981Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 2121982Protein automated matches [226838] (4 species)
    not a true protein
  7. 2121983Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries)
  8. 2121992Domain d4u39g1: 4u39 G:14-201 [270648]
    Other proteins in same PDB: d4u39a2, d4u39b2, d4u39c2, d4u39d2, d4u39e2, d4u39f2, d4u39g2, d4u39i2
    automated match to d2vxya1
    complexed with po4

Details for d4u39g1

PDB Entry: 4u39 (more details), 3.19 Å

PDB Description: crystal structure of ftsz:mciz complex from bacillus subtilis
PDB Compounds: (G:) cell division protein ftsz

SCOPe Domain Sequences for d4u39g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u39g1 c.32.1.0 (G:14-201) automated matches {Bacillus subtilis [TaxId: 1423]}
ikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglgaga
npevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgvvt
rpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlrqg
vqgisdli

SCOPe Domain Coordinates for d4u39g1:

Click to download the PDB-style file with coordinates for d4u39g1.
(The format of our PDB-style files is described here.)

Timeline for d4u39g1: