SCOPe 2.06: Domain d4u39i1: 4u39 I:13-201

Lineage for d4u39i1 (4u39 I:13-201)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.0: automated matches [227136] (1 protein)
   not a true family

6. Protein automated matches [226838] (4 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries)

8. Domain d4u39i1: 4u39 I:13-201 [270650]
   Other proteins in same PDB: d4u39a2, d4u39b2, d4u39c2, d4u39d2, d4u39e2, d4u39f2, d4u39g2, d4u39i2
   automated match to d2vxya1
   complexed with po4

Details for d4u39i1

PDB Entry: 4u39, 3.19 Å

PDB Description: crystal structure of ftsz:mciz complex from bacillus subtilis

PDB Compounds: (I:) cell division protein ftsz

SCOPe Domain Sequences for d4u39i1:

Sequence; same for both SEQRES and ATOM records:

>d4u39i1 c.32.1.0 (I:13-201) automated matches {Bacillus subtilis [TaxId: 1423]}
sikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglgag
anpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgvv
trpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlrq
gvqgisdli

Timeline for d4u39i1:

• d4u39i1 first appeared in SCOPe 2.05
  
• d4u39i1 appears in SCOPe 2.07
  
• d4u39i1 appears in the current release, SCOPe 2.08