Lineage for d4u39e2 (4u39 E:211-313)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201804Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2201805Protein automated matches [226843] (8 species)
    not a true protein
  7. 2201806Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries)
  8. 2201813Domain d4u39e2: 4u39 E:211-313 [270636]
    Other proteins in same PDB: d4u39a1, d4u39b1, d4u39c1, d4u39d1, d4u39e1, d4u39f1, d4u39g1, d4u39h1, d4u39i1
    automated match to d2vxya2
    complexed with po4

Details for d4u39e2

PDB Entry: 4u39 (more details), 3.19 Å

PDB Description: crystal structure of ftsz:mciz complex from bacillus subtilis
PDB Compounds: (E:) cell division protein ftsz

SCOPe Domain Sequences for d4u39e2:

Sequence, based on SEQRES records: (download)

>d4u39e2 d.79.2.0 (E:211-313) automated matches {Bacillus subtilis [TaxId: 1423]}
fadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggtnl
slyevqeaadivasasdqdvnmifgsvinenlkdeivvtviat

Sequence, based on observed residues (ATOM records): (download)

>d4u39e2 d.79.2.0 (E:211-313) automated matches {Bacillus subtilis [TaxId: 1423]}
fadvktimsnsalmgigiaraaeaakkaisspeaaidgaqgvlmnitggtnlslyevqea
adivasasdqdvnmifgsvinenlkdeivvtviat

SCOPe Domain Coordinates for d4u39e2:

Click to download the PDB-style file with coordinates for d4u39e2.
(The format of our PDB-style files is described here.)

Timeline for d4u39e2: