| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
| Protein automated matches [226843] (8 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries) |
| Domain d4u39g2: 4u39 G:212-314 [270649] Other proteins in same PDB: d4u39a1, d4u39b1, d4u39c1, d4u39d1, d4u39e1, d4u39f1, d4u39g1, d4u39h1, d4u39i1 automated match to d2vxya2 complexed with po4 |
PDB Entry: 4u39 (more details), 3.19 Å
SCOPe Domain Sequences for d4u39g2:
Sequence, based on SEQRES records: (download)
>d4u39g2 d.79.2.0 (G:212-314) automated matches {Bacillus subtilis [TaxId: 1423]}
advktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggtnls
lyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatg
>d4u39g2 d.79.2.0 (G:212-314) automated matches {Bacillus subtilis [TaxId: 1423]}
advktimsgsalmgigiaaeaakkaissplleaaidgaqgvlmnitggtnlslyevqeaa
divasasdqdvnmifgsvinenlvvtviatg
Timeline for d4u39g2: