SCOPe 2.07: Domain d4wswc_: 4wsw C:

Lineage for d4wswc_ (4wsw C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)

8. Domain d4wswc_: 4wsw C: [269522]
   Other proteins in same PDB: d4wswb_, d4wswd_, d4wswf_
   automated match to d3gbna_
   complexed with nag

Details for d4wswc_

PDB Entry: 4wsw, 2.8 Å

PDB Description: the crystal structure of hemagglutinin from a/green-winged teal/texas/y171/2006 influenza virus

PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wswc_:

Sequence; same for both SEQRES and ATOM records:

>d4wswc_ b.19.1.0 (C:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschpigm
vigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgftygs
sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgihhps
stqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdnitfs
hnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvgqcp
kyvnkkslllatgmrnvpe

Timeline for d4wswc_:

• d4wswc_ first appeared in SCOPe 2.05
  
• d4wswc_ appears in SCOPe 2.06
  
• d4wswc_ appears in the current release, SCOPe 2.08