Lineage for d4wswb_ (4wsw B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646598Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)
  8. 2646614Domain d4wswb_: 4wsw B: [269518]
    Other proteins in same PDB: d4wswa_, d4wswc_, d4wswe_
    automated match to d4uo4b_
    complexed with nag

Details for d4wswb_

PDB Entry: 4wsw (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin from a/green-winged teal/texas/y171/2006 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wswb_ h.3.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln

SCOPe Domain Coordinates for d4wswb_:

Click to download the PDB-style file with coordinates for d4wswb_.
(The format of our PDB-style files is described here.)

Timeline for d4wswb_: