Lineage for d4wswc_ (4wsw C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778763Species Influenza A virus [TaxId:11320] [228462] (15 PDB entries)
  8. 1778785Domain d4wswc_: 4wsw C: [269522]
    Other proteins in same PDB: d4wswb_, d4wswd_, d4wswf_
    automated match to d3gbna_
    complexed with nag

Details for d4wswc_

PDB Entry: 4wsw (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin from a/green-winged teal/texas/y171/2006 influenza virus
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wswc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wswc_ b.19.1.0 (C:) automated matches {Influenza A virus [TaxId: 11320]}
gdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschpigm
vigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgftygs
sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgihhps
stqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdnitfs
hnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvgqcp
kyvnkkslllatgmrnvpe

SCOPe Domain Coordinates for d4wswc_:

Click to download the PDB-style file with coordinates for d4wswc_.
(The format of our PDB-style files is described here.)

Timeline for d4wswc_: