![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
![]() | Domain d4wswc_: 4wsw C: [269522] Other proteins in same PDB: d4wswb_, d4wswd_, d4wswf_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4wsw (more details), 2.8 Å
SCOPe Domain Sequences for d4wswc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wswc_ b.19.1.0 (C:) automated matches {Influenza A virus, different strains [TaxId: 11320]} gdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschpigm vigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgftygs sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgihhps stqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdnitfs hnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvgqcp kyvnkkslllatgmrnvpe
Timeline for d4wswc_: