Lineage for d4po4b_ (4po4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851986Species Lampetra planeri [TaxId:7750] [268556] (1 PDB entry)
  8. 2851988Domain d4po4b_: 4po4 B: [268557]
    automated match to d3wo9a_

Details for d4po4b_

PDB Entry: 4po4 (more details), 2.5 Å

PDB Description: Crystal Structure of Lampetra planeri VLRC
PDB Compounds: (B:) Lampetra planeri VLRC

SCOPe Domain Sequences for d4po4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4po4b_ c.10.2.0 (B:) automated matches {Lampetra planeri [TaxId: 7750]}
acfaagkddlctcsnktesspetvdcsskklttvptgiptsteklqlnynqltgipptaf
qgltkltylnldsnqlqylpvgvfdqlknlnelrldfnklkslpprvfdrltnltalyle
ynqlqsipkgvfdklvnletlwlrenklqsvpdgafdsltkvemlqlhnnpwdcacsdii
ylrtfiakntdkisgmesaqcngtstavkdvktepiknvpc

SCOPe Domain Coordinates for d4po4b_:

Click to download the PDB-style file with coordinates for d4po4b_.
(The format of our PDB-style files is described here.)

Timeline for d4po4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4po4a_