PDB entry 4po4

View 4po4 on RCSB PDB site
Description: Crystal Structure of Lampetra planeri VLRC
Class: Immune System
Keywords: Jawless Vertebrate, Immune System, VLRC, Leucine Rich Repeat, Variable Lymphocyte Receptor, Antigen Binding
Deposited on 2014-02-24, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lampetra planeri VLRC
    Species: Lampetra planeri [TaxId:7750]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PO4 (0-220)
    Domains in SCOPe 2.07: d4po4a_
  • Chain 'B':
    Compound: Lampetra planeri VLRC
    Species: Lampetra planeri [TaxId:7750]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PO4 (0-220)
    Domains in SCOPe 2.07: d4po4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4po4A (A:)
    acfaagkddlctcsnktesspetvdcsskklttvptgiptsteklqlnynqltgipptaf
    qgltkltylnldsnqlqylpvgvfdqlknlnelrldfnklkslpprvfdrltnltalyle
    ynqlqsipkgvfdklvnletlwlrenklqsvpdgafdsltkvemlqlhnnpwdcacsdii
    ylrtfiakntdkisgmesaqcngtstavkdvktepiknvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4po4B (B:)
    acfaagkddlctcsnktesspetvdcsskklttvptgiptsteklqlnynqltgipptaf
    qgltkltylnldsnqlqylpvgvfdqlknlnelrldfnklkslpprvfdrltnltalyle
    ynqlqsipkgvfdklvnletlwlrenklqsvpdgafdsltkvemlqlhnnpwdcacsdii
    ylrtfiakntdkisgmesaqcngtstavkdvktepiknvpc