SCOPe 2.05: Domain d4po4b_: 4po4 B:

Lineage for d4po4b_ (4po4 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (10 species)
   not a true protein

7. Species Lampetra planeri [TaxId:7750] [268556] (1 PDB entry)

8. Domain d4po4b_: 4po4 B: [268557]
   automated match to d3wo9a_

Details for d4po4b_

PDB Entry: 4po4, 2.5 Å

PDB Description: Crystal Structure of Lampetra planeri VLRC

PDB Compounds: (B:) Lampetra planeri VLRC

SCOPe Domain Sequences for d4po4b_:

Sequence; same for both SEQRES and ATOM records:

>d4po4b_ c.10.2.0 (B:) automated matches {Lampetra planeri [TaxId: 7750]}
acfaagkddlctcsnktesspetvdcsskklttvptgiptsteklqlnynqltgipptaf
qgltkltylnldsnqlqylpvgvfdqlknlnelrldfnklkslpprvfdrltnltalyle
ynqlqsipkgvfdklvnletlwlrenklqsvpdgafdsltkvemlqlhnnpwdcacsdii
ylrtfiakntdkisgmesaqcngtstavkdvktepiknvpc

Timeline for d4po4b_:

• d4po4b_ is new in SCOPe 2.05-stable
  
• d4po4b_ appears in SCOPe 2.06
  
• d4po4b_ appears in the current release, SCOPe 2.08