Lineage for d1am5__ (1am5 -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Pepsin(ogen) [50658] (4 species) 
Species Atlantic cod (Gadus morhua) [TaxId:8049] [50662] (1 PDB entry) 
Domain d1am5__: 1am5 - [26855]
Details for d1am5__
PDB Entry: 1am5 (more details), 2.16 Å
PDB Description: the crystal structure and proposed amino acid sequence of a pepsin from atlantic cod (gadus morhua)
SCOP Domain Sequences for d1am5__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1am5__ b.50.1.2 (-) Pepsin(ogen) {Atlantic cod (Gadus morhua)}
rvteqmkneadteyygvisigtppesfkvifdtgssnlwvssshcsaqacsnhnkfkprq
sstyvetgktvdltygtggmrgilgqdtvsvgggsdpnqelgesqtepgpfqaaapfdgi
lglaypsiaaagavpvfdnmgsqslvekdlfsfylsgggangsevmlggvdnshytgsih
wipvtaekywqvaldgitvngqtaacegcqaivdtgtskivapvsalanimkdigasenq
gemmgncasvqslpditftingvkqplppsayiegdqafctsglgssgvpsntselwifg
dvflrnyytiydrtnnkvgfapaa
SCOP Domain Coordinates for d1am5__:
Click to download the PDB-style file with coordinates for d1am5__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1am5__:
- d1am5__ appears in SCOP 1.57
- d1am5__ appears in the current release, SCOPe 2.08, called d1am5a_
View in 3D