Lineage for d1am5a_ (1am5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060854Protein Pepsin(ogen) [50658] (4 species)
  7. 2060855Species Atlantic cod (Gadus morhua) [TaxId:8049] [50662] (1 PDB entry)
  8. 2060856Domain d1am5a_: 1am5 A: [26855]

Details for d1am5a_

PDB Entry: 1am5 (more details), 2.16 Å

PDB Description: the crystal structure and proposed amino acid sequence of a pepsin from atlantic cod (gadus morhua)
PDB Compounds: (A:) pepsin

SCOPe Domain Sequences for d1am5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]}
rvteqmkneadteyygvisigtppesfkvifdtgssnlwvssshcsaqacsnhnkfkprq
sstyvetgktvdltygtggmrgilgqdtvsvgggsdpnqelgesqtepgpfqaaapfdgi
lglaypsiaaagavpvfdnmgsqslvekdlfsfylsgggangsevmlggvdnshytgsih
wipvtaekywqvaldgitvngqtaacegcqaivdtgtskivapvsalanimkdigasenq
gemmgncasvqslpditftingvkqplppsayiegdqafctsglgssgvpsntselwifg
dvflrnyytiydrtnnkvgfapaa

SCOPe Domain Coordinates for d1am5a_:

Click to download the PDB-style file with coordinates for d1am5a_.
(The format of our PDB-style files is described here.)

Timeline for d1am5a_: