PDB entry 1am5

View 1am5 on RCSB PDB site
Description: the crystal structure and proposed amino acid sequence of a pepsin from atlantic cod (gadus morhua)
Class: aspartyl protease
Keywords: aspartyl protease, acid proteinase, hydrolase
Deposited on 1997-06-23, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsin
    Species: Gadus morhua [TaxId:8049]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1am5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1am5A (A:)
    rvteqmkneadteyygvisigtppesfkvifdtgssnlwvssshcsaqacsnhnkfkprq
    sstyvetgktvdltygtggmrgilgqdtvsvgggsdpnqelgesqtepgpfqaaapfdgi
    lglaypsiaaagavpvfdnmgsqslvekdlfsfylsgggangsevmlggvdnshytgsih
    wipvtaekywqvaldgitvngqtaacegcqaivdtgtskivapvsalanimkdigasenq
    gemmgncasvqslpditftingvkqplppsayiegdqafctsglgssgvpsntselwifg
    dvflrnyytiydrtnnkvgfapaa