Lineage for d4uvaa2 (4uva A:274-654,A:764-836)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849464Protein Lysine-specific histone demethylase 1, LSD1 [159432] (1 species)
  7. 2849465Species Human (Homo sapiens) [TaxId:9606] [159433] (27 PDB entries)
    Uniprot O60341 274-654,764-836
  8. 2849486Domain d4uvaa2: 4uva A:274-654,A:764-836 [267490]
    Other proteins in same PDB: d4uvaa1, d4uvaa3, d4uvab1, d4uvab2
    complexed with d73

Details for d4uvaa2

PDB Entry: 4uva (more details), 2.9 Å

PDB Description: LSD1(KDM1A)-CoREST in complex with 1-Methyl-Tranylcypromine (1R,2S)
PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d4uvaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uvaa2 c.3.1.2 (A:274-654,A:764-836) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
ptkktgkviiigsgvsglaaarqlqsfgmdvtlleardrvggrvatfrkgnyvadlgamv
vtglggnpmavvskqvnmelakikqkcplyeangqavpkekdemveqefnrlleatsyls
hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlke
kikelhqqykeasevkpprditaeflvkskhrdltalckeydelaetqgkleeklqelea
nppsdvylssrdrqildwhfanlefanatplstlslkhwdqdddfeftgshltvrngysc
vpvalaegldiklntavrqvrytasgceviavntrstsqtfiykcdavlctlplgvlkqq
ppavqfvpplpewktsavqrmXvaagssgndydlmaqpitpgpsipgapqpiprlffage
htirnypatvhgallsglreagriadqflgamytl

SCOPe Domain Coordinates for d4uvaa2:

Click to download the PDB-style file with coordinates for d4uvaa2.
(The format of our PDB-style files is described here.)

Timeline for d4uvaa2: