| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein REST corepressor 1, CoREST [140165] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries) Uniprot Q9UKL0 376-440 |
| Domain d4uvab2: 4uva B:376-440 [267493] Other proteins in same PDB: d4uvaa1, d4uvaa2, d4uvaa3, d4uvab1 complexed with d73 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4uva (more details), 2.9 Å
SCOPe Domain Sequences for d4uvab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uvab2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae
Timeline for d4uvab2: