Lineage for d4lufa2 (4luf A:196-387)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730921Species Sheep (Ovis aries) [TaxId:9940] [259659] (4 PDB entries)
  8. 2730926Domain d4lufa2: 4luf A:196-387 [266704]
    automated match to d3uiva1
    complexed with 2q5, act, fmt, lmr, mli, sin

Details for d4lufa2

PDB Entry: 4luf (more details), 2.3 Å

PDB Description: Crystal Structure of Ovine Serum Albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4lufa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lufa2 a.126.1.0 (A:196-387) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
rlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhkecchgdllecadd
radlakyicdhqdalssklkeccdkpvlekshciaevdkdavpenlppltadfaedkevc
knyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccakedphacyatvfdk
lkhlvdepqnli

SCOPe Domain Coordinates for d4lufa2:

Click to download the PDB-style file with coordinates for d4lufa2.
(The format of our PDB-style files is described here.)

Timeline for d4lufa2: