![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (6 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [259659] (4 PDB entries) |
![]() | Domain d4lufa2: 4luf A:196-387 [266704] automated match to d3uiva1 complexed with 2q5, act, fmt, lmr, mli, sin |
PDB Entry: 4luf (more details), 2.3 Å
SCOPe Domain Sequences for d4lufa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lufa2 a.126.1.0 (A:196-387) automated matches {Sheep (Ovis aries) [TaxId: 9940]} rlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhkecchgdllecadd radlakyicdhqdalssklkeccdkpvlekshciaevdkdavpenlppltadfaedkevc knyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccakedphacyatvfdk lkhlvdepqnli
Timeline for d4lufa2: