| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
| Protein automated matches [254493] (6 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [259659] (4 PDB entries) |
| Domain d4lufa3: 4luf A:388-583 [266705] automated match to d1n5ua3 complexed with 2q5, act, fmt, lmr, mli, sin |
PDB Entry: 4luf (more details), 2.3 Å
SCOPe Domain Sequences for d4lufa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lufa3 a.126.1.0 (A:388-583) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdekfft
fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf
vlegpklvastqaala
Timeline for d4lufa3: