Lineage for d4lufa1 (4luf A:1-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337197Species Sheep (Ovis aries) [TaxId:9940] [259659] (3 PDB entries)
  8. 2337201Domain d4lufa1: 4luf A:1-195 [266703]
    automated match to d3uiva1
    complexed with 2q5, act, fmt, lmr, mli, sin

Details for d4lufa1

PDB Entry: 4luf (more details), 2.3 Å

PDB Description: Crystal Structure of Ovine Serum Albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4lufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lufa1 a.126.1.0 (A:1-195) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
gcdkslhtlfgdelckvatlretygdmadccekqepernecflnhkddspdlpklkpepd
tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
idamrekvlassarq

SCOPe Domain Coordinates for d4lufa1:

Click to download the PDB-style file with coordinates for d4lufa1.
(The format of our PDB-style files is described here.)

Timeline for d4lufa1: