PDB entry 4luf

View 4luf on RCSB PDB site
Description: Crystal Structure of Ovine Serum Albumin
Class: transport protein
Keywords: Helical structure, transport, Fatty acids, metabolites, TRANSPORT PROTEIN
Deposited on 2013-07-25, released 2014-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lufa1, d4lufa2, d4lufa3
  • Heterogens: 2Q5, LMR, ACT, MLI, SIN, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lufA (A:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflnhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    idamrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdalssklkeccdkpvlekshciaevdkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdekfftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfvlegpklvastqaala