| Class b: All beta proteins [48724] (180 folds) |
| Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
| Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
| Protein automated matches [254706] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
| Domain d4fyra1: 4fyr A:66-287 [266279] Other proteins in same PDB: d4fyra2, d4fyra3, d4fyra4, d4fyra5 automated match to d4p8qa1 complexed with acy, bes, nag, so4, zn |
PDB Entry: 4fyr (more details), 1.91 Å
SCOPe Domain Sequences for d4fyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyra1 b.98.1.0 (A:66-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihsk
klnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefege
laddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlta
lsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef
Timeline for d4fyra1:
View in 3DDomains from same chain: (mouse over for more information) d4fyra2, d4fyra3, d4fyra4, d4fyra5 |