| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
| Domain d4fyra3: 4fyr A:549-636 [266281] Other proteins in same PDB: d4fyra1, d4fyra2, d4fyra4, d4fyra5 automated match to d4p8qa3 complexed with acy, bes, nag, so4, zn |
PDB Entry: 4fyr (more details), 1.91 Å
SCOPe Domain Sequences for d4fyra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyra3 b.1.30.0 (A:549-636) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlidvraq
ndlfstsgnewvllnlnvtgyyrvnyde
Timeline for d4fyra3:
View in 3DDomains from same chain: (mouse over for more information) d4fyra1, d4fyra2, d4fyra4, d4fyra5 |