PDB entry 4fyr

View 4fyr on RCSB PDB site
Description: Human aminopeptidase N (CD13) in complex with bestatin
Class: hydrolase/hydrolase inhibitor
Keywords: metalloprotease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-05, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Homo sapiens [TaxId:9606]
    Gene: ANPEP, APN, CD13, PEPN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15144 (1-902)
      • expression tag (0)
    Domains in SCOPe 2.07: d4fyra1, d4fyra2, d4fyra3, d4fyra4, d4fyra5
  • Heterogens: NAG, BMA, ZN, BES, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fyrA (A:)
    pdqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihs
    kklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefeg
    eladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlt
    alsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsefdyvekqasngvliriwa
    rpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyre
    nsllfdplsssssnkervvtviahelahqwfgnlvtiewwndlwlnegfasyveylgady
    aeptwnlkdlmvlndvyrvmavdalasshplstpaseintpaqiselfdaisyskgasvl
    rmlssflsedvfkqglasylhtfayqntiylnlwdhlqeavnnrsiqlpttvrdimnrwt
    lqmgfpvitvdtstgtlsqehflldpdsnvtrpsefnyvwivpitsirdgrqqqdywlid
    vraqndlfstsgnewvllnlnvtgyyrvnydeenwrkiqtqlqrdhsaipvinraqiind
    afnlasahkvpvtlalnntlflieerqympweaalsslsyfklmfdrsevygpmknylkk
    qvtplfihfrnntnnwreipenlmdqysevnaistacsngvpeceemvsglfkqwmenpn
    nnpihpnlrstvycnaiaqggeeewdfaweqfrnatlvneadklraalacskelwilnry
    lsytlnpdlirkqdatstiisitnnvigqglvwdfvqsnwkklfndygggsfsfsnliqa
    vtrrfsteyelqqleqfkkdneetgfgsgtraleqalektkanikwvkenkevvlqwfte
    nsk