Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (7 species) not a true protein |
Species Thermochromatium tepidum [TaxId:1050] [267912] (1 PDB entry) |
Domain d3wmmm_: 3wmm M: [265703] Other proteins in same PDB: d3wmm0_, d3wmm2_, d3wmm4_, d3wmm6_, d3wmm8_, d3wmmb_, d3wmmc_, d3wmme_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmj_, d3wmmn_, d3wmmp_, d3wmmr_, d3wmmt_, d3wmmv_, d3wmmx_, d3wmmz_ automated match to d1eysm_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmmm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmmm_ f.26.1.1 (M:) automated matches {Thermochromatium tepidum [TaxId: 1050]} peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmaglf ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr gtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavkh gmapaypevvtavnpyeta
Timeline for d3wmmm_: