Lineage for d3wmmb_ (3wmm B:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955548Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 1955549Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 1955603Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 1955604Protein automated matches [254444] (2 species)
    not a true protein
  7. 1955607Species Thermochromatium tepidum [TaxId:1050] [267909] (1 PDB entry)
  8. 1955613Domain d3wmmb_: 3wmm B: [265696]
    Other proteins in same PDB: d3wmmc_, d3wmmh1, d3wmmh2, d3wmmm_
    automated match to d1wrga_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmb_

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (B:) LH1 beta polypeptide

SCOPe Domain Sequences for d3wmmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmmb_ f.3.1.0 (B:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
tgltddeakefhaifmqsmyawfglvviahllawlyrpwl

SCOPe Domain Coordinates for d3wmmb_:

Click to download the PDB-style file with coordinates for d3wmmb_.
(The format of our PDB-style files is described here.)

Timeline for d3wmmb_: