Lineage for d3wmmc_ (3wmm C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751105Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1751106Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1751211Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 1751234Protein automated matches [227073] (2 species)
    not a true protein
  7. 1751237Species Thermochromatium tepidum [TaxId:1050] [267911] (1 PDB entry)
  8. 1751238Domain d3wmmc_: 3wmm C: [265697]
    Other proteins in same PDB: d3wmm0_, d3wmm2_, d3wmm4_, d3wmm6_, d3wmm8_, d3wmmb_, d3wmme_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmj_, d3wmmm_, d3wmmn_, d3wmmp_, d3wmmr_, d3wmmt_, d3wmmv_, d3wmmx_, d3wmmz_
    automated match to d1eysc_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmc_

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (C:) Photosynthetic reaction center C subunit

SCOPe Domain Sequences for d3wmmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmmc_ a.138.1.2 (C:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
svmllgcegpppgteqigyrgvgmenyynkrqralsiqanqpveslpaadstgpkasevy
qnvqvlkdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvra
ansdwkahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslp
fdpltpfldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctfchntraf
ndwtqstpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnk
plygaqmakdypglykt

SCOPe Domain Coordinates for d3wmmc_:

Click to download the PDB-style file with coordinates for d3wmmc_.
(The format of our PDB-style files is described here.)

Timeline for d3wmmc_: