![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
![]() | Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
![]() | Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
![]() | Protein automated matches [254444] (2 species) not a true protein |
![]() | Species Thermochromatium tepidum [TaxId:1050] [267909] (1 PDB entry) |
![]() | Domain d3wmm4_: 3wmm 4: [265693] Other proteins in same PDB: d3wmmc_, d3wmmh1, d3wmmh2, d3wmmm_ automated match to d1wrga_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmm4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmm4_ f.3.1.0 (4:) automated matches {Thermochromatium tepidum [TaxId: 1050]} tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
Timeline for d3wmm4_: