| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
| Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
| Protein automated matches [254444] (2 species) not a true protein |
| Species Thermochromatium tepidum [TaxId:1050] [267909] (1 PDB entry) |
| Domain d3wmm2_: 3wmm 2: [265692] Other proteins in same PDB: d3wmmc_, d3wmmh1, d3wmmh2, d3wmmm_ automated match to d1wrga_ complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8 |
PDB Entry: 3wmm (more details), 3.01 Å
SCOPe Domain Sequences for d3wmm2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wmm2_ f.3.1.0 (2:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
tgltddeakefhaifmqsmyawfglvviahllawlyrpwl
Timeline for d3wmm2_: