Lineage for d1befa_ (1bef A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15540Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 15541Protein NS3 protease [50600] (2 species)
  7. 15542Species Dengue virus serotype 2 [50602] (2 PDB entries)
  8. 15543Domain d1befa_: 1bef A: [26419]

Details for d1befa_

PDB Entry: 1bef (more details), 2.1 Å

PDB Description: crystal structure of dengue virus ns3 serine protease

SCOP Domain Sequences for d1befa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1befa_ b.47.1.3 (A:) NS3 protease {Dengue virus serotype 2}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOP Domain Coordinates for d1befa_:

Click to download the PDB-style file with coordinates for d1befa_.
(The format of our PDB-style files is described here.)

Timeline for d1befa_: