PDB entry 1bef

View 1bef on RCSB PDB site
Description: crystal structure of dengue virus ns3 serine protease
Deposited on 1998-05-14, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1befa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1befA (A:)
    wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
    iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
    avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd