Lineage for d1a1r.2 (1a1r B:,D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797068Protein NS3 protease [50600] (5 species)
  7. 2797078Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
    Uniprot P27958 1027-1206,1678-1669
    Uniprot P26662 1029-1202,1677-1689
    Uniprot O36579 1054-1207
  8. 2797082Domain d1a1r.2: 1a1r B:,D: [26407]
    complexed with zn

Details for d1a1r.2

PDB Entry: 1a1r (more details), 2.5 Å

PDB Description: hcv ns3 protease domain:ns4a peptide complex
PDB Compounds: (B:) ns3 protein, (D:) ns4a protein

SCOPe Domain Sequences for d1a1r.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1a1r.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgagt
rtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfipvenlettmrX
kgsvvivgrivlsgkpaiipk

SCOPe Domain Coordinates for d1a1r.2:

Click to download the PDB-style file with coordinates for d1a1r.2.
(The format of our PDB-style files is described here.)

Timeline for d1a1r.2: