PDB entry 1a1r

View 1a1r on RCSB PDB site
Description: hcv ns3 protease domain:ns4a peptide complex
Class: Viral protein
Keywords: viral protein, serine protease, nonstructural proteins, cofactor peptide, helicase
Deposited on 1997-12-15, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ns3 protein
    Species: Hepatitis C virus [TaxId:11103]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (Start-189)
      • variant (83)
    Domains in SCOPe 2.07: d1a1r.1
  • Chain 'B':
    Compound: ns3 protein
    Species: Hepatitis C virus [TaxId:11103]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (Start-189)
      • variant (83)
    Domains in SCOPe 2.07: d1a1r.2
  • Chain 'C':
    Compound: ns4a protein
    Species: Hepatitis C virus [TaxId:11103]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (2-End)
      • variant (3)
    Domains in SCOPe 2.07: d1a1r.1
  • Chain 'D':
    Compound: ns4a protein
    Species: Hepatitis C virus [TaxId:11103]
    Gene: NS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27958 (2-20)
      • variant (3)
    Domains in SCOPe 2.07: d1a1r.2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a1rA (A:)
    asmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcing
    vcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrh
    advipvrrrgdsrgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfi
    pvenlettmrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1rA (A:)
    vegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpap
    qgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcptg
    havglfraavctrgvakavdfipvenlettmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a1rB (B:)
    asmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcing
    vcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrh
    advipvrrrgdsrgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfi
    pvenlettmrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1rB (B:)
    pitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgagt
    rtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrgd
    srgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfipvenlettmr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a1rC (C:)
    kkgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1rC (C:)
    gsvvivgrivlsgkpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a1rD (D:)
    kkgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a1rD (D:)
    kgsvvivgrivlsgkpaiipk