Lineage for d4oujb1 (4ouj B:11-153)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2401958Species Clostridium botulinum [TaxId:498213] [257331] (1 PDB entry)
  8. 2401961Domain d4oujb1: 4ouj B:11-153 [263346]
    automated match to d4lo0a1
    complexed with lbt

Details for d4oujb1

PDB Entry: 4ouj (more details), 1.46 Å

PDB Description: crystal structure of ha33b-lac
PDB Compounds: (B:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4oujb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oujb1 b.42.2.0 (B:11-153) automated matches {Clostridium botulinum [TaxId: 498213]}
lndkivtisckantdlffyqvpgngnvslfqqtrnylerwriiydsnkaaykiksmniyn
tnlvltwnapthnisaqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnssyikfiiedyvisdfk

SCOPe Domain Coordinates for d4oujb1:

Click to download the PDB-style file with coordinates for d4oujb1.
(The format of our PDB-style files is described here.)

Timeline for d4oujb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4oujb2